China (Mainland)
Anakinra (IL-1Ra) CAS NO.143090-92-0
- Min.Order: 0 Milligram
- Payment Terms:
- Product Details
Keywords
- 143090-92-0
- Anakinra (IL-1Ra)
- Human interleukin-1 receptor antagonist (IL-1Ra)
Quick Details
- ProName: Anakinra (IL-1Ra)
- CasNo: 143090-92-0
- Molecular Formula: C759H1186N208O232S10
- Application: Anakinra is a recombinant, nonglycosyl...
- ProductionCapacity: Gram/Month
- Purity: 98%
- LimitNum: 0 Milligram
Superiority
Anakinra is a recombinant, nonglycosylated human interleukin-1 receptor antagonist (IL-1Ra). It is manufactured by using the E. coli expression system. Anakinra is composed of 153 amino acid residues.
Details
| Chemical Name | Human interleukin-1 receptor antagonist; IL-1Ra |
| Purity | 98% |
| Sequences |
MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLG IHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGW FLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE |
| Protein average weight | 17257.6 Da |
| Protein chemical formula | C759H1186N208O232S10 |
| CAS # | 143090-92-0 |
| Storage | ≤-20℃ |
Anakinra is a recombinant, nonglycosylated human interleukin-1 receptor antagonist (IL-1Ra). It is manufactured by using the E. coli expression system. Anakinra is composed of 153 amino acid residues.
For research use only. Not for use in humans.